CD147 (BSG) (NM_198589) Human Mass Spec Standard
CAT#: PH303894
BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203894 |
| Predicted MW | 29.2 kDa |
| Protein Sequence |
>RC203894 protein sequence
Red=Cloning site Green=Tags(s) MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQ KTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWY KITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALW PFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_940991 |
| RefSeq Size | 1759 |
| RefSeq ORF | 807 |
| Synonyms | 5F7; CD147; EMMPRIN; EMPRIN; OK; SLC7A11; TCSF |
| Locus ID | 682 |
| UniProt ID | P35613, Q54A51 |
| Cytogenetics | 19p13.3 |
| Summary | 'The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403688 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC403695 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419777 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403688 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 |
USD 436.00 |
|
| LY403695 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 |
USD 436.00 |
|
| LY419777 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 |
USD 436.00 |
|
| PH319418 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) |
USD 2,055.00 |
|
| PH319464 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) |
USD 2,055.00 |
|
| TP303894 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
USD 823.00 |
|
| TP319418 | Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4 |
USD 748.00 |
|
| TP319464 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1 |
USD 748.00 |
|
| TP720365 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China