CD147 (BSG) (NM_198589) Human Mass Spec Standard

CAT#: PH303894

BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991)

Product Images

Coomassie blue staining of purified BSG protein (Cat# TP303894). The protein was produced from HEK293T cells transfected with BSG cDNA clone (Cat# RC203894) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203894
• Predicted MW: 29.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203894 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQ
  KTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWY
  KITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALW
  PFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940991
• RefSeq Size: 1759
• RefSeq ORF: 807
• Synonyms: 5F7; CD147; EMMPRIN; EMPRIN; OK; SLC7A11; TCSF
• Locus ID: 682
• UniProt ID: P35613, Q54A51
• Cytogenetics: 19p13.3
• Summary: 'The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane