CD147 (BSG) (NM_198591) Human Mass Spec Standard
CAT#: PH319418
BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219418 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC219418 representing NM_198591
Red=Cloning site Green=Tags(s) MKQSDASPQERVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRS HLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_940993 |
RefSeq Size | 1609 |
RefSeq ORF | 615 |
Synonyms | 5F7; CD147; EMMPRIN; EMPRIN; OK; SLC7A11; TCSF |
Locus ID | 682 |
UniProt ID | P35613 |
Cytogenetics | 19p13.3 |
Summary | 'The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403688 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403695 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419777 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403688 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 |
USD 396.00 |
|
LY403695 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 |
USD 396.00 |
|
LY419777 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 |
USD 396.00 |
|
PH303894 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) |
USD 2,055.00 |
|
PH319464 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) |
USD 2,055.00 |
|
TP303894 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
USD 823.00 |
|
TP319418 | Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4 |
USD 748.00 |
|
TP319464 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1 |
USD 748.00 |
|
TP720365 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review