LMO4 (NM_006769) Human Mass Spec Standard

CAT#: PH303914

LMO4 MS Standard C13 and N15-labeled recombinant protein (NP_006760)

Product Images

Coomassie blue staining of purified LMO4 protein (Cat# TP303914). The protein was produced from HEK293T cells transfected with LMO4 cDNA clone (Cat# RC203914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203914
• Predicted MW: 18 kDa
• Protein Sequence:
  Sequence Link

  >RC203914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM
  ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
  RPTALINGHLNSLQSNPLLPDQKVC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006760
• RefSeq Size: 5415
• RefSeq ORF: 495
• Synonyms: LIM domain only 4; OTTHUMP00000011905; OTTHUMP00000011906
• Locus ID: 8543
• UniProt ID: P61968
• Cytogenetics: 1p22.3
• Summary: This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq, Aug 2008]
• Protein Families: Transcription Factors