LMO4 (NM_006769) Human Recombinant Protein

CAT#: TP303914

Recombinant protein of human LIM domain only 4 (LMO4)

Product Images

Coomassie blue staining of purified LMO4 protein (Cat# TP303914). The protein was produced from HEK293T cells transfected with LMO4 cDNA clone (Cat# RC203914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM
  ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
  RPTALINGHLNSLQSNPLLPDQKVC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006760
• Locus ID: 8543
• UniProt ID: P61968
• Cytogenetics: 1p22.3
• Refseq Size: 5415
• Refseq ORF: 495
• Summary: This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq, Aug 2008]
• Protein Families: Transcription Factors