MINA53 (MINA) (NM_153182) Human Mass Spec Standard
CAT#: PH303931
MINA MS Standard C13 and N15-labeled recombinant protein (NP_694822)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203931 |
Predicted MW | 52.8 kDa |
Protein Sequence |
>RC203931 protein sequence
Red=Cloning site Green=Tags(s) MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDETQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_694822 |
RefSeq Size | 4875 |
RefSeq ORF | 1395 |
Synonyms | JMJD10; MDIG; MINA; MINA53; NO52; ROX |
Locus ID | 84864 |
UniProt ID | Q8IUF8 |
Cytogenetics | 3q11.2 |
Summary | MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]). [supplied by OMIM, May 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407126 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420967 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425769 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407126 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 2 |
USD 396.00 |
|
LY420967 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 |
USD 605.00 |
|
LY425769 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 |
USD 396.00 |
|
TP303931 | Recombinant protein of human MYC induced nuclear antigen (MINA), transcript variant 2 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review