MINA53 (MINA) (NM_153182) Human Recombinant Protein
CAT#: TP303931
Recombinant protein of human MYC induced nuclear antigen (MINA), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203931 protein sequence
Red=Cloning site Green=Tags(s) MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDETQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694822 |
Locus ID | 84864 |
UniProt ID | Q8IUF8 |
Cytogenetics | 3q11.2 |
Refseq Size | 4875 |
Refseq ORF | 1395 |
Synonyms | JMJD10; MDIG; MINA; MINA53; NO52; ROX |
Summary | MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407126 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420967 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425769 | MINA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407126 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 2 |
USD 396.00 |
|
LY420967 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 |
USD 605.00 |
|
LY425769 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 |
USD 396.00 |
|
PH303931 | MINA MS Standard C13 and N15-labeled recombinant protein (NP_694822) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review