RCL (DNPH1) (NM_006443) Human Mass Spec Standard

CAT#: PH303989

C6orf108 MS Standard C13 and N15-labeled recombinant protein (NP_006434)

Product Images

Coomassie blue staining of purified DNPH1 protein (Cat# TP303989). The protein was produced from HEK293T cells transfected with DNPH1 cDNA clone (Cat# RC203989) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203989
• Predicted MW: 19.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203989 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA
  GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF
  QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006434
• RefSeq Size: 662
• RefSeq ORF: 522
• Synonyms: C6orf108; dJ330M21.3; RCL
• Locus ID: 10591
• UniProt ID: O43598
• Cytogenetics: 6p21.1
• Summary: This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq, Jul 2008]