RCL (DNPH1) (NM_006443) Human Recombinant Protein

CAT#: TP303989

Recombinant protein of human chromosome 6 open reading frame 108 (C6orf108), transcript variant 1

Product Images

Coomassie blue staining of purified DNPH1 protein (Cat# TP303989). The protein was produced from HEK293T cells transfected with DNPH1 cDNA clone (Cat# RC203989) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203989 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA
  GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF
  QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006434
• Locus ID: 10591
• UniProt ID: O43598
• Cytogenetics: 6p21.1
• Refseq Size: 662
• Refseq ORF: 522
• Synonyms: C6orf108; dJ330M21.3; RCL
• Summary: This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq, Jul 2008]