Tropomyosin 2 (TPM2) (NM_213674) Human Mass Spec Standard
CAT#: PH304007
TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204007 |
Predicted MW | 33 kDa |
Protein Sequence |
>RC204007 protein sequence
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE LNNL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_998839 |
RefSeq Size | 1182 |
RefSeq ORF | 852 |
Synonyms | AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB |
Locus ID | 7169 |
UniProt ID | P07951, V9HW25 |
Cytogenetics | 9p13.3 |
Summary | 'This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009]' |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403737 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC418786 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403737 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 2 |
USD 325.00 |
|
LY418786 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1 |
USD 325.00 |
|
PH319648 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003280) |
USD 2,055.00 |
|
TP304007 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 2 |
USD 823.00 |
|
TP319648 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review