Tropomyosin 2 (TPM2) (NM_213674) Human Recombinant Protein
CAT#: TP304007
Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204007 protein sequence
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE LNNL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_998839 |
| Locus ID | 7169 |
| UniProt ID | P07951, V9HW25 |
| Cytogenetics | 9p13.3 |
| Refseq Size | 1182 |
| Refseq ORF | 852 |
| Synonyms | AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB |
| Summary | This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009] |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403737 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418786 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403737 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 2 |
USD 396.00 |
|
| LY418786 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1 |
USD 436.00 |
|
| PH304007 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839) |
USD 2,055.00 |
|
| PH319648 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003280) |
USD 2,055.00 |
|
| TP319648 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China