SF20 (MYDGF) (NM_019107) Human Mass Spec Standard

CAT#: PH304011

C19orf10 MS Standard C13 and N15-labeled recombinant protein (NP_061980)

Product Images

Coomassie blue staining of purified MYDGF protein (Cat# TP304011). The protein was produced from HEK293T cells transfected with MYDGF cDNA clone (Cat# RC204011) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204011
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204011 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ
  GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE
  FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061980
• RefSeq Size: 1067
• RefSeq ORF: 519
• Synonyms: C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20
• Locus ID: 56005
• UniProt ID: Q969H8
• Cytogenetics: 19p13.3
• Summary: The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein