SF20 (MYDGF) (NM_019107) Human Recombinant Protein

CAT#: TP304011

Recombinant protein of human chromosome 19 open reading frame 10 (C19orf10)

Product Images

Coomassie blue staining of purified MYDGF protein (Cat# TP304011). The protein was produced from HEK293T cells transfected with MYDGF cDNA clone (Cat# RC204011) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204011 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ
  GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE
  FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061980
• Locus ID: 56005
• UniProt ID: Q969H8
• Cytogenetics: 19p13.3
• Refseq Size: 1067
• Refseq ORF: 519
• Synonyms: C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20
• Summary: The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein