EFEMP1 (NM_001039349) Human Mass Spec Standard
CAT#: PH304090
EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034438)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204090 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC204090 protein sequence
Red=Cloning site Green=Tags(s) MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC LPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIR RNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGE QCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN QGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGP FSF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001034438 |
RefSeq Size | 3053 |
RefSeq ORF | 1479 |
Synonyms | DHRD; DRAD; FBLN3; FBNL; FIBL-3; MLVT; MTLV; S1-5 |
Locus ID | 2202 |
UniProt ID | Q12805, A0A0S2Z4F1 |
Cytogenetics | 2p16.1 |
Summary | 'This gene encodes a member of the fibulin family of extracellular matrix glycoproteins. Like all members of this family, the encoded protein contains tandemly repeated epidermal growth factor-like repeats followed by a C-terminus fibulin-type domain. This gene is upregulated in malignant gliomas and may play a role in the aggressive nature of these tumors. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy. Alternatively spliced transcript variants that encode the same protein have been described.[provided by RefSeq, Nov 2009]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418212 | EFEMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418212 | Transient overexpression lysate of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1 |
USD 325.00 |
|
PH314953 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_004096) |
USD 2,055.00 |
|
PH316753 | EFEMP1 MS Standard C13 and N15-labeled recombinant protein (NP_001034437) |
USD 2,055.00 |
|
TP304090 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 3 |
USD 823.00 |
|
TP314953 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 1 |
USD 823.00 |
|
TP316753 | Recombinant protein of human EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review