SGK2 (NM_170693) Human Mass Spec Standard

CAT#: PH304101

SGK2 MS Standard C13 and N15-labeled recombinant protein (NP_733794)

Product Images

Coomassie blue staining of purified SGK2 protein (Cat# TP304101). The protein was produced from HEK293T cells transfected with SGK2 cDNA clone (Cat# RC204101) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204101
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204101 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKS
  ILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYA
  AEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEP
  YDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSK
  ADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASS
  AFLGFSYAPEDDDILDC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_733794
• RefSeq Size: 1913
• RefSeq ORF: 1101
• Synonyms: dJ138B7.2; H-SGK2
• Locus ID: 10110
• UniProt ID: Q9HBY8
• Cytogenetics: 20q13.12
• Summary: This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome, Protein Kinase