SGK2 (NM_170693) Human Recombinant Protein

CAT#: TP304101

Recombinant protein of human serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1

Product Images

Coomassie blue staining of purified SGK2 protein (Cat# TP304101). The protein was produced from HEK293T cells transfected with SGK2 cDNA clone (Cat# RC204101) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204101 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKS
  ILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYA
  AEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEP
  YDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSK
  ADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASS
  AFLGFSYAPEDDDILDC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_733794
• Locus ID: 10110
• UniProt ID: Q9HBY8
• Cytogenetics: 20q13.12
• Refseq Size: 1913
• Refseq ORF: 1101
• Synonyms: dJ138B7.2; H-SGK2
• Summary: This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome, Protein Kinase