EB3 (MAPRE3) (NM_012326) Human Mass Spec Standard

CAT#: PH304135

MAPRE3 MS Standard C13 and N15-labeled recombinant protein (NP_036458)

Product Images

Coomassie blue staining of purified MAPRE3 protein (Cat# TP304135). The protein was produced from HEK293T cells transfected with MAPRE3 cDNA clone (Cat# RC204135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204135
• Predicted MW: 32 kDa
• Protein Sequence:
  Sequence Link

  >RC204135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE
  YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN
  PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV
  DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE
  Y
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036458
• RefSeq Size: 1880
• RefSeq ORF: 843
• Synonyms: EB3; EBF3; EBF3-S; RP3
• Locus ID: 22924
• UniProt ID: Q9UPY8
• Cytogenetics: 2p23.3
• Summary: The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]