EB3 (MAPRE3) (NM_012326) Human Recombinant Protein

CAT#: TP304135

Recombinant protein of human microtubule-associated protein, RP/EB family, member 3 (MAPRE3)

Product Images

Coomassie blue staining of purified MAPRE3 protein (Cat# TP304135). The protein was produced from HEK293T cells transfected with MAPRE3 cDNA clone (Cat# RC204135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE
  YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN
  PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV
  DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE
  Y
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036458
• Locus ID: 22924
• UniProt ID: Q9UPY8
• Cytogenetics: 2p23.3
• Refseq Size: 1880
• Refseq ORF: 843
• Synonyms: EB3; EBF3; EBF3-S; RP3
• Summary: The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]