Prostaglandin dehydrogenase 1 (HPGD) (NM_000860) Human Mass Spec Standard
CAT#: PH304160
HPGD MS Standard C13 and N15-labeled recombinant protein (NP_000851)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204160 |
| Predicted MW | 29 kDa |
| Protein Sequence |
>RC204160 protein sequence
Red=Cloning site Green=Tags(s) MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000851 |
| RefSeq Size | 3044 |
| RefSeq ORF | 798 |
| Synonyms | 15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1 |
| Locus ID | 3248 |
| UniProt ID | P15428 |
| Cytogenetics | 4q34.1 |
| Summary | 'This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400305 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429019 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400305 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1 |
USD 436.00 |
|
| LY429019 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 2 |
USD 436.00 |
|
| TP304160 | Recombinant protein of human hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China