Prostaglandin dehydrogenase 1 (HPGD) (NM_000860) Human Recombinant Protein
CAT#: TP304160
Recombinant protein of human hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204160 protein sequence
Red=Cloning site Green=Tags(s) MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQ LRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLA GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHI KDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000851 |
| Locus ID | 3248 |
| UniProt ID | P15428 |
| Cytogenetics | 4q34.1 |
| Refseq Size | 3044 |
| Refseq ORF | 798 |
| Synonyms | 15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1 |
| Summary | This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400305 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429019 | HPGD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400305 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1 |
USD 436.00 |
|
| LY429019 | Transient overexpression lysate of hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 2 |
USD 436.00 |
|
| PH304160 | HPGD MS Standard C13 and N15-labeled recombinant protein (NP_000851) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China