DRAK2 (STK17B) (NM_004226) Human Mass Spec Standard

CAT#: PH304169

STK17B MS Standard C13 and N15-labeled recombinant protein (NP_004217)

Product Images

Coomassie blue staining of purified STK17B protein (Cat# TP304169). The protein was produced from HEK293T cells transfected with STK17B cDNA clone (Cat# RC204169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204169
• Predicted MW: 42.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRG
  QDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIK
  QILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYD
  PITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEK
  RPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV
  SKRFRFDDSLPNPHELVSDLLC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004217
• RefSeq Size: 5324
• RefSeq ORF: 1116
• Synonyms: DRAK2
• Locus ID: 9262
• UniProt ID: O94768, Q53QE7
• Cytogenetics: 2q32.3
• Protein Families: Druggable Genome, Protein Kinase