DRAK2 (STK17B) (NM_004226) Human Recombinant Protein

CAT#: TP304169

Recombinant protein of human serine/threonine kinase 17b (STK17B)

Product Images

Coomassie blue staining of purified STK17B protein (Cat# TP304169). The protein was produced from HEK293T cells transfected with STK17B cDNA clone (Cat# RC204169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRG
  QDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIK
  QILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYD
  PITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEK
  RPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV
  SKRFRFDDSLPNPHELVSDLLC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004217
• Locus ID: 9262
• UniProt ID: O94768, Q53QE7
• Cytogenetics: 2q32.3
• Refseq Size: 5324
• Refseq ORF: 1116
• Synonyms: DRAK2
• Summary: Phosphorylates myosin light chains (By similarity). Acts as a positive regulator of apoptosis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protein Kinase