MelanA (MLANA) (NM_005511) Human Mass Spec Standard

CAT#: PH304190

MLANA MS Standard C13 and N15-labeled recombinant protein (NP_005502)

Product Images

Coomassie blue staining of purified MLANA protein (Cat# TP304190). The protein was produced from HEK293T cells transfected with MLANA cDNA clone (Cat# RC204190) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204190
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204190 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL
  TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005502
• RefSeq Size: 1524
• RefSeq ORF: 354
• Synonyms: MART-1; MART1
• Locus ID: 2315
• UniProt ID: Q16655, A0A384MR46
• Cytogenetics: 9p24.1
• Summary: ''
• Protein Families: Transmembrane