MelanA (MLANA) (NM_005511) Human Recombinant Protein

CAT#: TP304190

Recombinant protein of human melan-A (MLANA)

Product Images

Coomassie blue staining of purified MLANA protein (Cat# TP304190). The protein was produced from HEK293T cells transfected with MLANA cDNA clone (Cat# RC204190) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204190 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL
  TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005502
• Locus ID: 2315
• UniProt ID: Q16655, A0A384MR46
• Cytogenetics: 9p24.1
• Refseq Size: 1524
• Refseq ORF: 354
• Synonyms: MART-1; MART1
• Summary: Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane