HOXB6 (NM_018952) Human Mass Spec Standard

CAT#: PH304197

HOXB6 MS Standard C13 and N15-labeled recombinant protein (NP_061825)

Product Images

Coomassie blue staining of purified HOXB6 protein (Cat# TP304197). The protein was produced from HEK293T cells transfected with HOXB6 cDNA clone (Cat# RC204197) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204197
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204197 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA
  PCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSS
  SFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSA
  SQLSAEEEEEKQAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061825
• RefSeq Size: 1686
• RefSeq ORF: 672
• Synonyms: Hox-2.2; HOX2; HOX2B; HU-2
• Locus ID: 3216
• UniProt ID: P17509
• Cytogenetics: 17q21.32
• Summary: 'This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors