HOXB6 (NM_018952) Human Recombinant Protein

CAT#: TP304197

Recombinant protein of human homeobox B6 (HOXB6)

Product Images

Coomassie blue staining of purified HOXB6 protein (Cat# TP304197). The protein was produced from HEK293T cells transfected with HOXB6 cDNA clone (Cat# RC204197) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204197 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA
  PCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSS
  SFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSA
  SQLSAEEEEEKQAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061825
• Locus ID: 3216
• UniProt ID: P17509
• Cytogenetics: 17q21.32
• Refseq Size: 1686
• Refseq ORF: 672
• Synonyms: Hox-2.2; HOX2; HOX2B; HU-2
• Summary: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors