Claudin 2 (CLDN2) (NM_020384) Human Mass Spec Standard

CAT#: PH304199

CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117)

Product Images

Coomassie blue staining of purified CLDN2 protein (Cat# TP304199). The protein was produced from HEK293T cells transfected with CLDN2 cDNA clone (Cat# RC204199) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204199
• Predicted MW: 24.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204199 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL
  LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL
  HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR
  PGQPPKVKSEFNSYSLTGYV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065117
• RefSeq Size: 2998
• RefSeq ORF: 690
• Synonyms: SP82
• Locus ID: 9075
• UniProt ID: P57739
• Cytogenetics: Xq22.3
• Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene. [provided by RefSeq, Jan 2010]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction