Claudin 2 (CLDN2) (NM_020384) Human Recombinant Protein
CAT#: TP304199
Recombinant protein of human claudin 2 (CLDN2)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204199 protein sequence
Red=Cloning site Green=Tags(s) MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR PGQPPKVKSEFNSYSLTGYV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065117 |
| Locus ID | 9075 |
| UniProt ID | P57739 |
| Cytogenetics | Xq22.3 |
| Refseq Size | 2998 |
| Refseq ORF | 690 |
| Synonyms | OAZON |
| Summary | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.[provided by RefSeq, Jan 2010] |
| Protein Families | Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402780 | CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432728 | CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402780 | Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 1 |
USD 436.00 |
|
| LY432728 | Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 2 |
USD 436.00 |
|
| PH304199 | CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China