DHRS1 (NM_138452) Human Mass Spec Standard

CAT#: PH304206

DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461)

Product Images

Coomassie blue staining of purified DHRS1 protein (Cat# TP304206). The protein was produced from HEK293T cells transfected with DHRS1 cDNA clone (Cat# RC204206) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204206
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204206 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE
  VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP
  AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV
  LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS
  VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612461
• RefSeq Size: 1488
• RefSeq ORF: 939
• Synonyms: SDR19C1
• Locus ID: 115817
• UniProt ID: Q96LJ7
• Cytogenetics: 14q12
• Summary: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
• Protein Families: Druggable Genome