DHRS1 (NM_138452) Human Recombinant Protein

CAT#: TP304206

Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2

Product Images

Coomassie blue staining of purified DHRS1 protein (Cat# TP304206). The protein was produced from HEK293T cells transfected with DHRS1 cDNA clone (Cat# RC204206) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204206 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE
  VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP
  AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV
  LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS
  VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612461
• Locus ID: 115817
• UniProt ID: Q96LJ7
• Cytogenetics: 14q12
• Refseq Size: 1488
• Refseq ORF: 939
• Synonyms: SDR19C1
• Summary: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
• Protein Families: Druggable Genome