Tcl1 (TCL1A) (NM_021966) Human Mass Spec Standard

CAT#: PH304243

TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_068801)

Product Images

Coomassie blue staining of purified TCL1A protein (Cat# TP304243). The protein was produced from HEK293T cells transfected with TCL1A cDNA clone (Cat# RC204243) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204243
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204243 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS
  LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068801
• RefSeq Size: 1410
• RefSeq ORF: 342
• Synonyms: TCL1
• Locus ID: 8115
• UniProt ID: P56279, A0A024R6G5
• Cytogenetics: 14q32.13
• Summary: Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]). [supplied by OMIM, Jul 2010]
• Protein Families: Druggable Genome