PITPNB (NM_012399) Human Mass Spec Standard

CAT#: PH304262

PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531)

Product Images

Coomassie blue staining of purified PITPNB protein (Cat# TP304262). The protein was produced from HEK293T cells transfected with PITPNB cDNA clone (Cat# RC204262) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204262
• Predicted MW: 31.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204262 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA
  FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH
  IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE
  NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036531
• RefSeq Size: 2981
• RefSeq ORF: 813
• Synonyms: PI-TP-beta; PtdInsTP; VIB1B
• Locus ID: 23760
• UniProt ID: P48739
• Cytogenetics: 22q12.1
• Summary: This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2013]