Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PITPNB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PITPNB. |
Antibodies
View as table Download
PITPNB (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 225-254 amino acids from the C-terminal region of human PITPNB |
Rabbit Polyclonal Anti-PITPNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITPNB antibody: synthetic peptide directed towards the middle region of human PITPNB. Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA |
Rabbit Polyclonal Anti-PITPNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITPNB antibody: synthetic peptide directed towards the middle region of human PITPNB. Synthetic peptide located within the following region: ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY |
Rabbit Polyclonal Anti-PITPNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITPNB antibody is: synthetic peptide directed towards the N-terminal region of Human PITPNB. Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA |
Mouse monoclonal Anti-PITPNB Clone 4a7
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PITPNB Clone 1C1
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
PITPNB rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PITPNB |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PITPNB mouse monoclonal antibody,clone OTI4A7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
PITPNB mouse monoclonal antibody,clone OTI5D11
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- PITPNB