PITPNB Rabbit Polyclonal Antibody

CAT#: TA334456

Rabbit Polyclonal Anti-PITPNB Antibody

Product Images

WB Suggested Anti-PITPNB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 721_B cell lysatePITPNB is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PITPNB antibody: synthetic peptide directed towards the middle region of human PITPNB. Synthetic peptide located within the following region: ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: phosphatidylinositol transfer protein beta
• Database Link:
  NP_036531
  Entrez Gene 23760 Human
  UniProt ID P48739
• Background: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
• Synonyms: PI-TP-beta; PtdInsTP; VIB1B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%; Zebrafish: 79%