RAP2B (NM_002886) Human Mass Spec Standard

CAT#: PH304287

RAP2B MS Standard C13 and N15-labeled recombinant protein (NP_002877)

Product Images

Coomassie blue staining of purified RAP2B protein (Cat# TP304287). The protein was produced from HEK293T cells transfected with RAP2B cDNA clone (Cat# RC204287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204287
• Predicted MW: 20.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
  YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC
  PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002877
• RefSeq Size: 8413
• RefSeq ORF: 549
• Synonyms: MGC20484
• Locus ID: 5912
• UniProt ID: P61225
• Cytogenetics: 3q25.2
• Summary: 'This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome