RAP2B (NM_002886) Human Recombinant Protein

CAT#: TP304287

Recombinant protein of human RAP2B, member of RAS oncogene family (RAP2B)

Product Images

Coomassie blue staining of purified RAP2B protein (Cat# TP304287). The protein was produced from HEK293T cells transfected with RAP2B cDNA clone (Cat# RC204287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
  YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC
  PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002877
• Locus ID: 5912
• UniProt ID: P61225
• Cytogenetics: 3q25.2
• Refseq Size: 8413
• Refseq ORF: 549
• Summary: This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome