EAF2 (NM_018456) Human Mass Spec Standard

CAT#: PH304314

EAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060926)

Product Images

Coomassie blue staining of purified EAF2 protein (Cat# TP304314). The protein was produced from HEK293T cells transfected with EAF2 cDNA clone (Cat# RC204314) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204314
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204314 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST
  PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL
  VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG
  NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060926
• RefSeq Size: 1024
• RefSeq ORF: 780
• Synonyms: BM040; TRAITS; U19
• Locus ID: 55840
• UniProt ID: Q96CJ1
• Cytogenetics: 3q13.33