GNLY (NM_006433) Human Mass Spec Standard

CAT#: PH304321

GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424)

Product Images

Coomassie blue staining of purified GNLY protein (Cat# TP304321). The protein was produced from HEK293T cells transfected with GNLY cDNA clone (Cat# RC204321) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204321
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204321 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL
  TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP
  STGPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006424
• RefSeq Size: 751
• RefSeq ORF: 435
• Synonyms: D2S69E; LAG-2; LAG2; NKG5; TLA519
• Locus ID: 10578
• UniProt ID: P22749
• Cytogenetics: 2p11.2
• Summary: The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein