ARH3 (ADPRHL2) (NM_017825) Human Mass Spec Standard

CAT#: PH304342

ADPRHL2 MS Standard C13 and N15-labeled recombinant protein (NP_060295)

Product Images

Coomassie blue staining of purified ADPRHL2 protein (Cat# TP304342). The protein was produced from HEK293T cells transfected with ADPRHL2 cDNA clone (Cat# RC204342) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204342
• Predicted MW: 38.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204342 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT
  EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPAR
  AQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSEH
  FLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTA
  IYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETD
  ILAQSLHRVFQKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060295
• RefSeq Size: 1701
• RefSeq ORF: 1089
• Synonyms: ARH3; CONDSIAS
• Locus ID: 54936
• UniProt ID: Q9NX46
• Cytogenetics: 1p34.3
• Summary: This gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm. [provided by RefSeq, Feb 2009]