NNT1 (CLCF1) (NM_013246) Human Mass Spec Standard
CAT#: PH304427
CLCF1 MS Standard C13 and N15-labeled recombinant protein (NP_037378)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204427 |
Predicted MW | 25.2 kDa |
Protein Sequence |
>RC204427 protein sequence
Red=Cloning site Green=Tags(s) MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFN EPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSL QGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQ PPAAAVTLHLGAHGF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037378 |
RefSeq Size | 1860 |
RefSeq ORF | 675 |
Synonyms | BSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6 |
Locus ID | 23529 |
UniProt ID | Q9UBD9 |
Cytogenetics | 11q13.2 |
Summary | This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402229 | CLCF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431793 | CLCF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402229 | Transient overexpression lysate of cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1 |
USD 396.00 |
|
LY431793 | Transient overexpression lysate of cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 2 |
USD 396.00 |
|
TP304427 | Recombinant protein of human cardiotrophin-like cytokine factor 1 (CLCF1) |
USD 439.00 |
|
TP328765 | Purified recombinant protein of Homo sapiens cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 2. |
USD 748.00 |
|
TP723332 | Purified recombinant protein of Human cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review