MAGEA4 (NM_001011549) Human Mass Spec Standard
CAT#: PH304482
MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011549)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204482 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC204482 protein sequence
Red=Cloning site Green=Tags(s) MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001011549 |
RefSeq Size | 1721 |
RefSeq ORF | 951 |
Synonyms | CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B |
Locus ID | 4103 |
UniProt ID | P43358, A0A024RC12 |
Cytogenetics | Xq28 |
Summary | 'This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423276 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425301 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425302 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429096 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY423276 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 4 |
USD 396.00 |
|
LY425301 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 1 |
USD 396.00 |
|
LY425302 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 3 |
USD 396.00 |
|
LY429096 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 |
USD 396.00 |
|
PH318952 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011548) |
USD 2,055.00 |
|
PH323991 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550) |
USD 2,055.00 |
|
TP304482 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 3 |
USD 823.00 |
|
TP318952 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 1 |
USD 823.00 |
|
TP323991 | Recombinant protein of human melanoma antigen family A, 4 (MAGEA4), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review