CD32B (FCGR2B) (NM_001002275) Human Mass Spec Standard

CAT#: PH304496

FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002275)

Product Images

Coomassie blue staining of purified FCGR2B protein (Cat# TP304496). The protein was produced from HEK293T cells transfected with FCGR2B cDNA clone (Cat# RC204496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204496
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204496 representing NM_001002275
  Red=Cloning site Green=Tags(s)
  
  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT
  CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHP
  EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV
  TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDE
  ADKVGAENTITYSLLMHPDALEEPDDQNRI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001002275
• RefSeq Size: 1630
• RefSeq ORF: 930
• Synonyms: CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
• Locus ID: 2213
• UniProt ID: P31994
• Cytogenetics: 1q23.3
• Summary: 'The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]'
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus