CD32B (FCGR2B) (NM_001002275) Human Recombinant Protein

CAT#: TP304496

Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4

Product Images

Coomassie blue staining of purified FCGR2B protein (Cat# TP304496). The protein was produced from HEK293T cells transfected with FCGR2B cDNA clone (Cat# RC204496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204496 representing NM_001002275
  Red=Cloning site Green=Tags(s)
  
  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT
  CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHP
  EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV
  TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDE
  ADKVGAENTITYSLLMHPDALEEPDDQNRI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001002275
• Locus ID: 2213
• UniProt ID: P31994
• Cytogenetics: 1q23.3
• Refseq Size: 1630
• Refseq ORF: 930
• Synonyms: CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
• Summary: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus