SNAIL (SNAI1) (NM_005985) Human Mass Spec Standard

CAT#: PH304581

SNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_005976)

Product Images

Coomassie blue staining of purified SNAI1 protein (Cat# TP304581). The protein was produced from HEK293T cells transfected with SNAI1 cDNA clone (Cat# RC204581) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204581
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204581 representing NM_005985
  Red=Cloning site Green=Tags(s)
  
  MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ
  PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA
  QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC
  PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005976
• RefSeq Size: 1708
• RefSeq ORF: 792
• Synonyms: dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1
• Locus ID: 6615
• UniProt ID: O95863
• Cytogenetics: 20q13.13
• Summary: 'The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction