RRAS2 (NM_012250) Human Mass Spec Standard
CAT#: PH304591
RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204591 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC204591 protein sequence
Red=Cloning site Green=Tags(s) MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036382 |
RefSeq Size | 2360 |
RefSeq ORF | 612 |
Synonyms | TC21 |
Locus ID | 22800 |
UniProt ID | P62070 |
Cytogenetics | 11p15.2 |
Summary | This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome |
Protein Pathways | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415877 | RRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415877 | Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1 |
USD 396.00 |
|
TP304591 | Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review