AP2 alpha (TFAP2A) (NM_001032280) Human Mass Spec Standard

CAT#: PH304603

TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451)

Product Images

Coomassie blue staining of purified TFAP2A protein (Cat# TP304603). The protein was produced from HEK293T cells transfected with TFAP2A cDNA clone (Cat# RC204603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204603
• Predicted MW: 47.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204603 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHV
  NDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGD
  LSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPG
  RLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANV
  TLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDR
  SPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNA
  KSSDKEEKHRK
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001027451
• RefSeq Size: 3808
• RefSeq ORF: 1293
• Synonyms: AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
• Locus ID: 7020
• UniProt ID: P05549
• Cytogenetics: 6p24.3
• Summary: 'The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009]'
• Protein Families: Druggable Genome, Transcription Factors