RBP4 (NM_006744) Human Mass Spec Standard

CAT#: PH304635

RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735)

Product Images

Coomassie blue staining of purified RBP4 protein (Cat# TP304635). The protein was produced from HEK293T cells transfected with RBP4 cDNA clone (Cat# RC204635) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204635
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC204635 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ
  MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL
  LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006735
• RefSeq Size: 941
• RefSeq ORF: 603
• Synonyms: MCOPCB10; RDCCAS
• Locus ID: 5950
• UniProt ID: P02753
• Cytogenetics: 10q23.33
• Summary: ' This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein