RBP4 (NM_006744) Human Recombinant Protein

CAT#: TP304635

Recombinant protein of human retinol binding protein 4, plasma (RBP4)

Product Images

Coomassie blue staining of purified RBP4 protein (Cat# TP304635). The protein was produced from HEK293T cells transfected with RBP4 cDNA clone (Cat# RC204635) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204635 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ
  MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL
  LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006735
• Locus ID: 5950
• UniProt ID: P02753
• Cytogenetics: 10q23.33
• Refseq Size: 941
• Refseq ORF: 603
• Synonyms: MCOPCB10; RDCCAS
• Summary: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein