GIMAP4 (NM_018326) Human Mass Spec Standard

CAT#: PH304653

GIMAP4 MS Standard C13 and N15-labeled recombinant protein (NP_060796)

Product Images

Coomassie blue staining of purified GIMAP4 protein (Cat# TP304653). The protein was produced from HEK293T cells transfected with GIMAP4 cDNA clone (Cat# RC204653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204653
• Predicted MW: 37.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204653 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE
  KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM
  FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ
  RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME
  KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060796
• RefSeq Size: 1983
• RefSeq ORF: 987
• Synonyms: IAN-1; IAN1; IMAP4; MSTP062
• Locus ID: 55303
• UniProt ID: Q9NUV9, A0A090N7X0
• Cytogenetics: 7q36.1
• Summary: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008]