GIMAP4 (NM_018326) Human Recombinant Protein

CAT#: TP304653

Recombinant protein of human GTPase, IMAP family member 4 (GIMAP4)

Product Images

Coomassie blue staining of purified GIMAP4 protein (Cat# TP304653). The protein was produced from HEK293T cells transfected with GIMAP4 cDNA clone (Cat# RC204653) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204653 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE
  KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM
  FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ
  RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME
  KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060796
• Locus ID: 55303
• UniProt ID: Q9NUV9, A0A090N7X0
• Cytogenetics: 7q36.1
• Refseq Size: 1983
• Refseq ORF: 987
• Synonyms: IAN-1; IAN1; IMAP4; MSTP062
• Summary: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008]