Apolipoprotein M (APOM) (NM_019101) Human Mass Spec Standard

CAT#: PH304679

APOM MS Standard C13 and N15-labeled recombinant protein (NP_061974)

Product Images

Coomassie blue staining of purified APOM protein (Cat# TP304679). The protein was produced from HEK293T cells transfected with APOM cDNA clone (Cat# RC204679) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204679
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204679 representing NM_019101
  Red=Cloning site Green=Tags(s)
  
  MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIV
  FNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQG
  YQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061974
• RefSeq Size: 790
• RefSeq ORF: 564
• Synonyms: apo-M; G3a; HSPC336; NG20
• Locus ID: 55937
• UniProt ID: O95445
• Cytogenetics: 6p21.33
• Summary: The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Secreted Protein